Protein information for: OR5K4



MARENHSLAAEFILIGFTNYPELKTLLFVVFSAIYLVTMVGNLGLVALIY
VERRLLTPMYIFLGNLALMDSCCSCAVTPKMLENFFSEDRIISLYECMAQ
FYFLCLAETTDCFLLATMAYDRYVAICHPLQYHTMMSKTLCIRMTTGAFK
AGNLHSMIHVGLLLRLTFCRSNKIHHFFCDILPLYRLSCTDPSINELMIY
IFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFSTCASHFLSVSI
FYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEVINVLKK
IMRNYNILKQTCSIANLFLIY
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 KTLLFVVFSAIYLVTMVGNLGLVALIY
TM2 61 83 IFLGNLALMDSCCSCAVTPKMLE
TM3 98 118 MAQFYFLCLAETTDCFLLATM
TM4 141 161 CIRMTTGAFKAGNLHSMIHVG
TM5 198 219 MIYIFSIPIQIFTIATVLISYL
TM6 241 264 CASHFLSVSIFYICLLMYIGPSEE
TM7 269 286 PVAIFYAIVIPLLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage