Protein information for: OR5M14P



FSFLFFSLDLIRSQANTMSKKHWTAIAEFIPLGPTDQAELQLVLFFVTFL
VIYLIMVMGNLSMILIIRSDXKLHIPMYFFLSHLSFAVLCYTLNVTPQIL
VNFLSKRKTIFFIGCVS
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 42 68 LVLFFVTFLVIYLIMVMGNLSMILIIR
TM2 79 101 FFLSHLSFAVLCYTLNVTPQILV
TM3 116 117 VS
TM4 117 116
TM5 117 116
TM6 117 116
TM7 117 116

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage