Protein information for: OR5M6P



MRRNCTLVTEFILLGLANHRELQIFLFTLFLTIYMVTVAGNLGMIALIQA
TPRLHTPMYFFLSNLSFVDLCFSSNVTPRMLEIFLSEKKSISYPARLVQC
YLFITLVHVELYILAVMAFDRYMAICNPLLYGSRMSKSVCSFLITVLYVY
GALTGLMETMWTYNLAFCGPSEINHFYCVDPPLIKLACSDTYNKEVSMFV
VAGFNFTYPLLIILISYLYIFPATLRICSTEGRHKAFSTCGSHLTAVTIF
YSALFFMYLRRPSEESMEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAL
CKELFKRKLFSK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 QIFLFTLFLTIYMVTVAGNLGMIALIQ
TM2 60 82 FFLSNLSFVDLCFSSNVTPRMLE
TM3 97 117 LVQCYLFITLVHVELYILAVM
TM4 140 160 CSFLITVLYVYGALTGLMETM
TM5 197 218 SMFVVAGFNFTYPLLIILISYL
TM6 240 264 CGSHLTAVTIFYSALFFMYLRRPSE
TM7 270 289 GKMVAVFYTTVIPMLNPMIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage