Protein information for: OR5P2



MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQ
LHHPMYFFLSHLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSA
AFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQLLLVVYIAGFL
IAVSYTTSFYFLLFCGPNQVNHFFCDFAPLLELSCSDISVSTVVLSFSSG
SIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGT
ITFIYVMPNFSYSTDQNKVVSVLYTVVIPMLNPLIYSLRNKEIKGALKRE
LVRKILSHDACYFSRTSNNDIT
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 45 DPILRVILFMIILSGNLSIIILIR
TM2 57 79 FFLSHLAFADMAYSSSVTPNMLV
TM3 94 114 AIQLGSAAFFATVECVLLAAM
TM4 137 157 SVQLLLVVYIAGFLIAVSYTT
TM5 194 215 VLSFSSGSIIVVTVCVIAVCYI
TM6 237 261 CTSHLTVVTLFYGTITFIYVMPNFS
TM7 267 286 NKVVSVLYTVVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage