Protein information for: OR5P4P



METENNTTVTEFIILGLTDNPMLCAIFFVFFLAVYIVTIPGNISIILLIQ
SSPQLHTLMYLFLSHLASVDIGYSISVTPIILINFLREKTTIPVTGCIAQ
LGSDVMFGTTECFLLDHYVAICSPLLYSIQMPPVVCFLLLGASYLGGCLN
ASSFTGCLMNLSFCGPNKINHFFCDLFPLLKLSCGHVYIAEISPAISSAS
VLISTLFTIIVSYIYILHSILKVCSTEGRKKAFSTCASHLTAVTLFYGTI
LFVYVMPKSSYSADQVKVAFVIYTVVIPMLNPLIYSLRNKEVKEAMRKLM
ARTHWFS
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 CAIFFVFFLAVYIVTIPGNISIILLIQ
TM2 61 83 LFLSHLASVDIGYSISVTPIILI
TM3 98 115 IAQLGSDVMFGTTECFLL
TM4 136 156 CFLLLGASYLGGCLNASSFTG
TM5 193 214 SPAISSASVLISTLFTIIVSYI
TM6 236 260 CASHLTAVTLFYGTILFVYVMPKSS
TM7 266 285 VKVAFVIYTVVIPMLNPLIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage