Protein information for: OR5S1P



MSTHRNGNLSVVPLWESMLKGLEGGLENQALLFAVFPGLYMVTIPGNLTM
TMVIILDTHLHFPVNFFLGASPFLDLGHASIIPNALVNFSSSSKVVTFAG
CAARFFFSLLSTTETFLLAVMAYDCFVAICSLVWCPVTTCLSICIILGPG
TYCRVCLSSIVQTGLMFQLPSAGTNHIDHYCDMPQLLRLACACLALNELT
KFSLCGLMMVNATLVVLVSFGCVTVTILRTPSGSQXHKVFTCSSHVMTVS
LFDGTVFVTYAQPGTMESMEQGKVVSVFYSLVIPMLGPFIYSLRNKDMKE
ALRRLGQRQALMGRMVA
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 QALLFAVFPGLYMVTIPGNLTMTMVII
TM2 66 87 FFLGASPFLDLGHASIIPNALV
TM3 102 121 AARFFFSLLSTTETFLLAVM
TM4 144 164 CIILGPGTYCRVCLSSIVQTG
TM5 200 221 TKFSLCGLMMVNATLVVLVSFG
TM6 242 266 CSSHVMTVSLFDGTVFVTYAQPGTM
TM7 272 291 GKVVSVFYSLVIPMLGPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage