Protein information for: OR6A2



MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAI
RNHSTLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFVGSKQDQLISFEGC
MTQLYFFLGLGCTECVLLAVMAYDRYMAICYPLHYPVIVSGRLCVQMAAG
SWAGGFGISMVKVFLISGLSYCGPNIINHFFCDVSPLLNLSCTDMSTAEL
TDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRYKAFSTCASHLTV
VIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQEV
KRALCCTLHLYQHQDPDPKKASRNV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 QVLLFALLLLAYVLVLTENTLIIMAIR
TM2 62 84 FFLANMSFLEIWYVTVTIPKMLA
TM3 101 121 MTQLYFFLGLGCTECVLLAVM
TM4 144 164 CVQMAAGSWAGGFGISMVKVF
TM5 201 222 TDFILAIFILLGPLSVTGASYV
TM6 244 268 CASHLTVVIIFYAASIFIYARPKAL
TM7 274 293 NKLVSVLYAVIVPLLNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage