Protein information for: OR6C5P



MRNHTTITEFVLLGISDSPELQIVIFIFLFITYVLSITDNLTIIILTLTD
SSLKTPMYYFLRNFSFSEITFTSVSIPKFLGAIITKVKTISYNNCLAQLF
FFIFMGASEFFLLAAMSYDRYVAICKPLHYTTIMNKKICTLLVFSSWLGG
FLTIFPPLTLILKLDFCASNVIDHFSCEYFPILQLSCSDIWLLEIIGFYF
AFVTLLITLALVILSYVCIICTILRIPCASQRTYSSHMIVISISYGSCIF
MYVKPSAKERASLTKGVAILNTSIAPMLNPSIYTLRNQQVKQAFKDLAHK
VVFYRNK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QIVIFIFLFITYVLSITDNLTIIILTL
TM2 59 81 YFLRNFSFSEITFTSVSIPKFLG
TM3 96 116 LAQLFFFIFMGASEFFLLAAM
TM4 139 159 CTLLVFSSWLGGFLTIFPPLT
TM5 196 217 IGFYFAFVTLLITLALVILSYV
TM6 234 258 YSSHMIVISISYGSCIFMYVKPSAK
TM7 264 283 TKGVAILNTSIAPMLNPSIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage