Protein information for: OR6C73P



LFLHLFYSXNKEXHNKERKKXVIRNCKAVIEFILLGLTSDPQWQVVLFIF
LATYMLSGTGNLIFIYSLTLSDPHLQTPMHFFLQNFSFLEISFMSVCIPR
FLVTIVTGDITISIMGCVSQLFYFILGVTKFYLLAAMSFDCYMILKSFXI
IYMLVFLYQTCGYCLHLFIVSFTVSTSSPTQANDFWRPLRTAKKRVQAYY
LXLLSPSKSMCHXXNXLSGLSSCDSDXVXGIWIXYWHLDFQPDLIILINV
NDCRKSNSLANSFHYCSKKLSLTITYFLPLCFHGMTHMFFQILTXYQQKT
KIMITLFTSSLLXHTIYKENETMQVFL
No N-glycosylation site was found.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 44 70 QVVLFIFLATYMLSGTGNLIFIYSLTL
TM2 81 103 FFLQNFSFLEISFMSVCIPRFLV
TM3 118 137 VSQLFYFILGVTKFYLLAAM
TM4 164 184 CLHLFIVSFTVSTSSPTQAND
TM5 220 241 LSSCDSDXVXGIWIXYWHLDFQ
TM6 266 290 CSKKLSLTITYFLPLCFHGMTHMFF
TM7 297 314 QQKTKIMITLFTSSLLXH

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage