Protein information for: OR6C76



MKNRTSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLD
SHLKTPMYFFLRNFSLEISFTSVCNPRFLISILTGDKSISYNACAAQLFF
FIFLGSTEFFLLASMSYDCYVAICKPLHYTTIMSDRICYQLIISSWLAGF
LVIFPPLAMGLQLDFCDSNVIDHFTCDSAPLLQISCTDTSTLELMSFILA
LFTLISTLILVILSYTYIIRTILRIPSAQQRKKAFSTCSSHVIVVSISYG
SCIFMYVKTSAKEGVALTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKD
VLRKISHKKKKH
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QVVIFSFLFLTYVLSVTGNLTIISLTL
TM2 59 80 FFLRNFSLEISFTSVCNPRFLI
TM3 95 115 AAQLFFFIFLGSTEFFLLASM
TM4 138 158 CYQLIISSWLAGFLVIFPPLA
TM5 195 216 MSFILALFTLISTLILVILSYT
TM6 238 262 CSSHVIVVSISYGSCIFMYVKTSAK
TM7 268 287 TKGVAILNTSVAPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage