Protein information for: OR6K1P



SXPQVIHPPQPPKVLGLXAXATAPSWLLFFILLLLIYLFTIIGSLMVFFA
IKLDFCLHSSLYFFISVLSFLEIWYTTITIPKMFFNLASEQKTTSLDGCL
LQMYFFYSLGITEVCLLTTRAMDRYLAICNHLCYPTVTTPXLYTQVILGC
CICGFFTLLPEIAWISTLPFCGPNQIHNIFCDLDPILNLACVDTGVLIKV
VDIVHAVEIITAIMLVTLAYVQIIAVILRNCSADGCQKAFSTYAFHLAIF
LIFFGSVALMYLLFSAKYSFFWDTTISLMFAVLSPTPIICSLRNKEIKEA
IKKHMCQSMICTHHVKXDQIHT
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 WLLFFILLLLIYLFTIIGSLMVFFAIK
TM2 63 85 FFISVLSFLEIWYTTITIPKMFF
TM3 100 120 LLQMYFFYSLGITEVCLLTTR
TM4 143 163 YTQVILGCCICGFFTLLPEIA
TM5 200 221 VVDIVHAVEIITAIMLVTLAYV
TM6 243 267 YAFHLAIFLIFFGSVALMYLLFSAK
TM7 273 290 DTTISLMFAVLSPTPIIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage