Protein information for: OR6K4P



VTEFLFSGFPQFEDGSLLFFIPLFVIYIFIVIGNLIVFFAVRVDTRLHNP
MYNFISIFSFLEIWYTTATIPKMLSILISRQRTISMVGCLLQMYFFHSLG
NSEGILLTTMAIDRYVAICNPLRYPTIMTPGLCVQLSVGSCIFGFLVLLP
EIAWISTLPFCGPNQIHQIFCDFEPVLRLACTDTSMILIEDVIHAVAIVF
SVLIIALSYIRIITVILRIPSVEGRQKAFSTCAAHLSVFLMFYGSVSLMY
LRFSATFPPILDTAVALMFAVLAPFFNPIIYSFRNKDMKIAIKK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 16 42 SLLFFIPLFVIYIFIVIGNLIVFFAVR
TM2 53 75 NFISIFSFLEIWYTTATIPKMLS
TM3 90 110 LLQMYFFHSLGNSEGILLTTM
TM4 133 153 CVQLSVGSCIFGFLVLLPEIA
TM5 189 210 IEDVIHAVAIVFSVLIIALSYI
TM6 232 256 CAAHLSVFLMFYGSVSLMYLRFSAT
TM7 262 281 DTAVALMFAVLAPFFNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage