Protein information for: OR6K6



MTQLTASGNQTMVTEFLFSMFPHAHRGGLLFFIPLLLIYGFILTGNLIMF
IVIQVGMALHTPLYFFISVLSFLEICYTTTTIPKMLSCLISEQKSISVAG
CLLQMYFFHSLGITESCVLTAMAIDRYIAICNPLRYPTIMIPKLCIQLTV
GSCFCGFLLVLPEIAWISTLPFCGSNQIHQIFCDFTPVLSLACTDTFLVV
IVDAIHAAEIVASFLVIALSYIRIIIVILGMHSAEGHHKAFSTCAAHLAV
FLLFFGSVAVMYLRFSATYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDM
KEAIGRLFHYQKRAGWAGK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 GLLFFIPLLLIYGFILTGNLIMFIVIQ
TM2 65 87 FFISVLSFLEICYTTTTIPKMLS
TM3 102 122 LLQMYFFHSLGITESCVLTAM
TM4 145 165 CIQLTVGSCFCGFLLVLPEIA
TM5 201 222 IVDAIHAAEIVASFLVIALSYI
TM6 244 268 CAAHLAVFLLFFGSVAVMYLRFSAT
TM7 274 293 DTAIAVTFVILAPFFNPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage