Protein information for: OR6L1P



CXEVTCLTRRATYNSSNTVVTEFVFLSFPELHHLQGLLFGLLLIIYVVTI
LEDLAVVGTIRASHHLHISTHLFLAQLSVLETLYTSVTVPKLLAGLPGTS
DDHLISFSGHLTWLLLFLSLSSSECVLPANMDCDWHPVICHLLHYPAHHG
LHAARLCLHLAISAQLSSFPASFVSTALNSSLRLRSPDVLNHFCDIPPPL
GLSCSSTTTIEMRTQAAQVILAASLQATTVSYTHILARSLRIPAKAQQLK
AFPTYASHLGWRPSNLIKLVSGVYLVGIPLLKPIIYCLRNCNIREALAKL
LQALPL
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 35 61 QGLLFGLLLIIYVVTILEDLAVVGTIR
TM2 72 94 LFLAQLSVLETLYTSVTVPKLLA
TM3 111 131 LTWLLLFLSLSSSECVLPANM
TM4 157 177 CLHLAISAQLSSFPASFVSTA
TM5 212 233 MRTQAAQVILAASLQATTVSYT
TM6 255 270 YASHLGWRPSNLIKLV
TM7 272 285 VYLVGIPLLKPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage