Protein information for: OR6L2P



SLSFWASQSCLTRRATYNSSNTVVTEFVFLSFPELRHLQGLLFGLLLIIY
VVTILEDLAVVGTIRASHHLHISTHLFLAKLSVLETLYTSVTVPKLLAGL
PGTSDDHLISFSGHLTWLLLFLSLSSSECILPANMDCDWHPVICHLLHYP
AHHGLHAARLCLHLAISAQLSSFPASFVSTALNSSLRLRSPDVLNHFCDI
PPPLGLSCSSTTTIEMRTQAAQVILAASLQATTVSYTHILARSLRIPAKA
QQLKAFPTYASHLGWRPSNLIKLVSGVYLVGIPLLKPIIYCLRNCNIREA
LAKLLQALPL
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 39 65 QGLLFGLLLIIYVVTILEDLAVVGTIR
TM2 76 98 LFLAKLSVLETLYTSVTVPKLLA
TM3 115 135 LTWLLLFLSLSSSECILPANM
TM4 161 181 CLHLAISAQLSSFPASFVSTA
TM5 216 237 MRTQAAQVILAASLQATTVSYT
TM6 259 274 YASHLGWRPSNLIKLV
TM7 276 289 VYLVGIPLLKPIIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage