Protein information for: OR6M1



MGNWSTVTEITLIAFPALLEIRISLFVVLVVTYTLTATGNITIISLIWID
HRLQTPMYFFLSNLSFLDILYTTVITPKLLACLLGEEKTISFAGCMIQTY
FYFFLGTVEFILLAVMSFDRYMAICDPLHYTVIMNSRACLLLVLGCWVGA
FLSVLFPTIVVTRLPYCRKEINHFFCDIAPLLQVACINTHLIEKINFLLS
ALVILSSLAFTTGSYVYIISTILRIPSTQGRQKAFSTCASHITVVSIAHG
SNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE
TVNRIMTLIQRKT
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 20 46 EIRISLFVVLVVTYTLTATGNITIISL
TM2 57 79 MYFFLSNLSFLDILYTTVITPKL
TM3 94 114 GCMIQTYFYFFLGTVEFILLA
TM4 137 157 RACLLLVLGCWVGAFLSVLFP
TM5 193 214 EKINFLLSALVILSSLAFTTGS
TM6 236 260 STCASHITVVSIAHGSNIFVYVRPN
TM7 267 284 DKVAAVLITVVTPLLNPF

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage