Protein information for: OR6M2P



AVDIQNQTTVTEFTLTAFPVLQQLQISLFAVLLFTYMLTLTGNVAIISLT
CANHRLQTPMYFFLSNLSILDIFFTTSVIPKLLACLLQDKKTISFAGCIT
QTYFFVFLGTVEFILLAVMSFDCYVAICDPLHYTIIMNSRACLLLVLGCW
VGAFLSVLCPTIVVSRLPFCYKEISHFFCDITPLLHVSCIDTHFIEMINF
LLSSLILLTSLVLTTVSYIYIISTILHIPSAQGRRKAFSTCASHITVISI
AYISNIFRYVRPSQSHSMGFDKVTAVPTMVTPLLNPFTYSLRNEKVKAVL
KEAVSKIMSSWHRRT
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 25 51 QISLFAVLLFTYMLTLTGNVAIISLTC
TM2 62 84 FFLSNLSILDIFFTTSVIPKLLA
TM3 99 119 ITQTYFFVFLGTVEFILLAVM
TM4 142 162 CLLLVLGCWVGAFLSVLCPTI
TM5 198 219 INFLLSSLILLTSLVLTTVSYI
TM6 241 265 CASHITVISIAYISNIFRYVRPSQS
TM7 270 289 FDKVTAVPTMVTPLLNPFTY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage