Protein information for: OR6M3P



MVTEFTLVSLPAVQELQIWLCVLLWLVHMLTITGNLFVIFLTWTDNCLQT
PMXLVPXKKVISFSGCITQIYFYFFLGTVAFIPLAVTSFKHCMATCDPLC
STIIAKSRACLLLALGCWMGTFLAVLRLTIVVSRLPDCTEKISPFFCDIA
SLLQVACIDIHFIEMISFLXSSLMVLTSLVLNATSYAYIISTLLCIPSAQ
GCQEAFSTCASHITIIFIACRNSISTCVRPNPRYXLDFDKVTAILTIVVT
SFLNPRIYSLRXRKYEGSQFAQYCHHIPKEHD
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 17 43 QIWLCVLLWLVHMLTITGNLFVIFLTW
TM2 50 56 PMXLVPX
TM3 67 87 ITQIYFYFFLGTVAFIPLAVT
TM4 110 130 CLLLALGCWMGTFLAVLRLTI
TM5 166 187 ISFLXSSLMVLTSLVLNATSYA
TM6 209 233 CASHITIIFIACRNSISTCVRPNPR
TM7 239 258 DKVTAILTIVVTSFLNPRIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage