Protein information for: OR6T1



MNPENWTQVTSFVLLGFPSSHLIQFLVFLGLMVTYIVTATGKLLIIVLSW
IDQRLHIQMYFFLRNFSFLELLLVTVVVPKMLVVILTGDHTISFVSCIIQ
SYLYFFLGTTDFFLLAVMSLDRYLAICRPLRYETLMNGHVCSQLVLASWL
AGFLWVLCPTVLMASLPFCGPNGIDHFFRDSWPLLRLSCGDTHLLKLVAF
MLSTLVLLGSLALTSVSYACILATVLRAPTAAERRKAFSTCASHLTVVVI
IYGSSIFLYIRMSEAQSKLLNKGASVLSCIITPLLNPFIFTLRNDKVQQA
LREALGWPRLTAVMKLRVTSQRK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 19 41 SHLIQFLVFLGLMVTYIVTATGK
TM2 54 75 RLHIQMYFFLRNFSFLELLLVT
TM3 90 110 HTISFVSCIIQSYLYFFLGTT
TM4 134 152 LMNGHVCSQLVLASWLAGF
TM5 190 211 GDTHLLKLVAFMLSTLVLLGSL
TM6 233 257 ERRKAFSTCASHLTVVVIIYGSSIF
TM7 271 281 KGASVLSCIIT

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage