Protein information for: OR6U2P



MANQTVVTEFFLQGLTDTKELQVAVFLLLLLAYLVTVSGNLIIISLTLLD
TRLQTSMYLFLQNLSCLEIWFQTVIVPKMLLNIAMGTKTVSFAGCITQDF
FHIFLGATEFFLLTAMAYDQYIAICKPLHYPMLISSRVCTQLILTCWLLG
FSFIIMPVILTSQLPFCDTHIKHFFCDYTPLMEVVCSGPKVLEMVDFTLA
LVALFGTLVLITLSYVQIIQTIVRIPAVQERKKAFSTCSSHVIMVTMCYD
SCFFMYVKPSPGKWVDVNKGVSLINTIIAPLLNPFICTLRNQQVKQVMKD
LVRKMTLFQNK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QVAVFLLLLLAYLVTVSGNLIIISLTL
TM2 59 81 LFLQNLSCLEIWFQTVIVPKMLL
TM3 96 116 ITQDFFHIFLGATEFFLLTAM
TM4 139 159 CTQLILTCWLLGFSFIIMPVI
TM5 195 216 VDFTLALVALFGTLVLITLSYV
TM6 238 262 CSSHVIMVTMCYDSCFFMYVKPSPG
TM7 268 286 KGVSLINTIIAPLLNPFIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage