Protein information for: OR6X1



MRNGTVITEFILLGFPVIQGLQTPLFIAIFLTYILTLAGNGLIIATVWAE
PRLQIPMYFFLCNLSFLEIWYTTTVIPKLLGTFVVARTVICMSCCLLQAF
FHFFVGTTEFLILTIMSFDRYLTICNPLHHPTIMTSKLCLQLALSSWVVG
FTIVFCQTMLLIQLPFCGNNVISHFYCDVGPSLKAACIDTSILELLGVIA
TILVIPGSLLFNMISYIYILSAILRIPSATGHQKTFSTCASHLTVVSLLY
GAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALR
KAMTCPKTGHAK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 22 48 QTPLFIAIFLTYILTLAGNGLIIATVW
TM2 59 81 FFLCNLSFLEIWYTTTVIPKLLG
TM3 96 116 LLQAFFHFFVGTTEFLILTIM
TM4 139 159 CLQLALSSWVVGFTIVFCQTM
TM5 196 217 LGVIATILVIPGSLLFNMISYI
TM6 239 263 CASHLTVVSLLYGAVLFMYLRPTAH
TM7 269 287 KVVSVLNTILTPLLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage