Protein information for: OR7A10



MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATI
SDSHLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQ
MCFFLLFVGLDNFLLTVMAYDRFVAICHPLHYMVIMNPQLCGLLVLASWI
MSVLNSMLQSLMVLPLPFCTHMEIPHFFCEINQVVHLACSDTFLNDIVMY
FAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSL
FYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA
MKTFFRGKQ
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 24 50 QAFLFGLFLSMYLVTVLGNLLIILATI
TM2 61 83 FFLSNLSFVDICFVSTTVPKMLV
TM3 98 118 ITQMCFFLLFVGLDNFLLTVM
TM4 141 161 CGLLVLASWIMSVLNSMLQSL
TM5 198 219 VMYFAVALLGGGPLTGILYSYS
TM6 241 265 CASHLSVVSLFYGTCLGVYLSSAAT
TM7 271 290 GAAASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage