Protein information for: OR7A11P



FSLILKVIINHIEPGNDTQISEFLLLGLSDKPELQPFLFGLFFSMYLVTV
LGNLLIILATISDSHLHTPMYFFLSNLSFADICFISTTIPKMLVNIQTQS
RVITYAGCITQMCFFVLLEALDSLLLTVMAYDQFVAICHPLHYMVIMSPM
SPWLCGLLVLAFWIISDLDSSLHSLMVLSLPFCTDFQIPHFVYELNQVIR
LAGSDTFLNDMAMYFAVGPLGGVPLAGILYLYCKIVFSIRAISSAQGKYK
AFSTCASHLSVVSLFYGRSLGVYFSSAPTQNSHSGAAASVMYTVVTPMLN
PFICSLRNKDIKRALNQFIRVVPFFRK
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 35 61 QPFLFGLFFSMYLVTVLGNLLIILATI
TM2 72 94 FFLSNLSFADICFISTTIPKMLV
TM3 109 129 ITQMCFFVLLEALDSLLLTVM
TM4 155 175 CGLLVLAFWIISDLDSSLHSL
TM5 212 233 AMYFAVGPLGGVPLAGILYLYC
TM6 255 279 CASHLSVVSLFYGRSLGVYFSSAPT
TM7 285 304 GAAASVMYTVVTPMLNPFIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage