Protein information for: OR7E100P



IFPILFSSQKKRCPSHTEPXNLTSVSEFLLQGLSEDPELQPVLAGLSLSM
YLVTVLRNLLIILAVSSDSHLHTPMYFFLSNLSWADIGFTSAMVPKMIVD
MQSHSRVISXAGCLTQMSFFVLFACIEDMLLTVMAYDQFVAICHPLHYPV
IMNPHLCVFLVLVSFFLSLLDSQLHSWIVLQFTFFKNVEISNFFCDPSQL
LNLACSDGIINSIFIYLDSILFSFLPISGILLSYYKIVPSILRISSSDGK
YKAFSICGSHLAVVCLFYGTGIGVYLTSAVSPPPGNGVVASVMYAVGTPM
LNSFIYSLRNRDIQSALWRLRSRTVESHDLFHPYSCVGK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 40 66 QPVLAGLSLSMYLVTVLRNLLIILAVS
TM2 77 99 FFLSNLSWADIGFTSAMVPKMIV
TM3 114 134 LTQMSFFVLFACIEDMLLTVM
TM4 157 177 CVFLVLVSFFLSLLDSQLHSW
TM5 214 235 FIYLDSILFSFLPISGILLSYY
TM6 257 281 CGSHLAVVCLFYGTGIGVYLTSAVS
TM7 287 306 GVVASVMYAVGTPMLNSFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage