Protein information for: OR7E105P



LSFSRCPRHTEPLNLTGVXFLLLGLSEDPELQPVLALLSLSLSMYLVTVL
RNLLSILAVSSDSHLHTPMYFFLSNLCWADIGYTSATVPKMIVDTQSHGR
VISHAGCLTQMSFLVLFACIEDMLLTVMAYDCFVAICCPLHYPVIVNPHL
CVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACS
DSVINSIFIYFDSTMFGFLPISGILLSYSKIVPSVLRMSSSDGKYKAFST
CGSHLAVVCXFDGTGIGMYLTSAVAPPPRNGVVESGMYAVVTPMLNLFIY
SLRNRHTQSALRRLRSRTVESHDLLHPFSCV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 34 60 VLALLSLSLSMYLVTVLRNLLSILAVS
TM2 71 93 FFLSNLCWADIGYTSATVPKMIV
TM3 108 128 LTQMSFLVLFACIEDMLLTVM
TM4 151 171 CVFFVLVSFFLSLLDSQLHSW
TM5 208 229 FIYFDSTMFGFLPISGILLSYS
TM6 251 275 CGSHLAVVCXFDGTGIGMYLTSAVA
TM7 281 300 GVVESGMYAVVTPMLNLFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage