Protein information for: OR7E10P



LFFSRCPSHTEPRNLTGVXKVLLGSLXEDPELQPILAGLSLSMYLVTVLR
NVLIILAVSSDSHLHTPMYFFLSSLCWADIGFTSATVPKMTVDMQSHSRV
ISYVSCLTQISFLVLFACMEDMLTVMAYDRVVAICHPLHYPVIMNPHLRV
FLVLLSFFLSLLDSQLHSWIVLQFTLFKNVENSSFVCDPSQLLNLACSDS
VINSIFIYFDSTMFGFLPISGILLSYYKIVPSILRMSSSDGKYKAFSTYG
SQLAALCXFYGTGIGMYLTSAVALPPRNGVVASVMXAVVTPMLNFFIYSL
RNRDIQSALRRLRSRTVESHDLFHPFSCV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 33 59 QPILAGLSLSMYLVTVLRNVLIILAVS
TM2 70 92 FFLSSLCWADIGFTSATVPKMTV
TM3 107 126 LTQISFLVLFACMEDMLTVM
TM4 149 169 RVFLVLLSFFLSLLDSQLHSW
TM5 206 227 FIYFDSTMFGFLPISGILLSYY
TM6 249 273 YGSQLAALCXFYGTGIGMYLTSAVA
TM7 279 298 GVVASVMXAVVTPMLNFFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage