Protein information for: OR7E111P



CPSHTEPWNLTGVXEFLLLGLSEDPELQPVLAGLSRSMYLVMVLRNLLII
LAVSSDSHLHTPMYFFLSNLCWADIGFTSAMVPKMIVDMQSHSRVISYAG
CLTRMSFLVLFACIEDMLLTAMAYDCFVAICRPLHYPVIVNPHLSVFLVL
VSFFLSLLDSQLHSXIVLQFTFFKNVEISNFVCEPSQLLNLACSDSVINS
IFLYFDSTMFGFLPISRILLSYYKIVPSILRISSSDGKYKAFSTCGSHLA
VVCLFYGTGIGVYLTSAVSPPPRSGVVASVMYAVVTPMLNPFIYSLRNRD
IQSALWRLRSRTVESHDLFHPFSCVGK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 QPVLAGLSRSMYLVMVLRNLLIILAVS
TM2 65 87 FFLSNLCWADIGFTSAMVPKMIV
TM3 102 122 LTRMSFLVLFACIEDMLLTAM
TM4 145 165 SVFLVLVSFFLSLLDSQLHSX
TM5 202 223 FLYFDSTMFGFLPISRILLSYY
TM6 245 269 CGSHLAVVCLFYGTGIGVYLTSAVS
TM7 275 294 GVVASVMYAVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage