Protein information for: OR7E116P



LVFIFYFSNPLFFPRCPSHTEPRHLTGVXEFLLLGLSEDPELQPVLAGLS
LSMYLVTVLRNLLIILAVSSDSHLHTPMYFFLSNLCWADISFTSATVPKM
TVDMQSHSRVISYAGCLTRMSFFVLFACIEDMLLTVMAXDCFVAICRPLH
YAVIVNPHLCVFLVLVSFFLSLLDSQLHSXIVLQFTFFKNVEISHFVCEP
SQLLNLACSDSFINSIFMYFDSTMFGFLPISGILLSYYKIVPSILRISSS
DGKYKAFSTCGSHLAVVCLFYGTGIGVYLTSAVAPPPSNGVVASVKYTVV
TPMLNPFIYSLRNRDIQSTLWRLCSRTVKSLDLFHSFSCVGK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 43 69 QPVLAGLSLSMYLVTVLRNLLIILAVS
TM2 80 102 FFLSNLCWADISFTSATVPKMTV
TM3 117 137 LTRMSFFVLFACIEDMLLTVM
TM4 160 180 CVFLVLVSFFLSLLDSQLHSX
TM5 217 238 FMYFDSTMFGFLPISGILLSYY
TM6 260 284 CGSHLAVVCLFYGTGIGVYLTSAVA
TM7 290 309 GVVASVKYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage