Protein information for: OR7E11P



NYTDPHSLTDVSIFLLLKLSEDPELQPVVAGLFLSMCLVTVLGNLLIILA
VSPDSHLHTPMYFILSNLPLPDIGFTSTTVPKMIVDIQSHSRVISYAGCL
TQMSLFAIFGGEEDMLLSVMAYGRFVAICHPLYRSAILNFCGFLVCCLRF
VLFFFLSLLDSQLHNLIALQMTGFKDVEIPNFFWEPSQLPHLACCDTFTR
NINLYFPAAVFGFLPILGTLFSYCKIVSSILRVSSSGGKYKAFSTCGSHL
PVVCXFCGTGVGGYLGSDVSSSPRKSAVASVMYTVVTPMLNPFMYSLRNR
DIKSVLRRPHGSTV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QPVVAGLFLSMCLVTVLGNLLIILAVS
TM2 63 85 FILSNLPLPDIGFTSTTVPKMIV
TM3 100 120 LTQMSLFAIFGGEEDMLLSVM
TM4 146 166 CCLRFVLFFFLSLLDSQLHNL
TM5 203 224 NLYFPAAVFGFLPILGTLFSYC
TM6 246 270 CGSHLPVVCXFCGTGVGGYLGSDVS
TM7 276 295 SAVASVMYTVVTPMLNPFMY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage