Protein information for: OR7E122P



MGLSEDPELQPVLAGLSLSMCLVTVLRNLLSILAVSSDSHLHTPMYFFLS
NLCWADIGFTSATVPKIIVDMQSHSRVISYVGCLTRMSFLVLFACIEDML
LTVMAYDCFVAICRPLHYPVIVNPHLRVFLVLVSFFLSLLDSQLHSXIVL
QFTFFKNVEISNFVCEPSQLLKLACSDSIINSIFIYFDSTMFGFLPISGI
LLSYCKIVPSILRISTSDGKYKAFSTCGSHLALVCLFYGAGIGVYLTSAV
SPPPRNGVVVSVMYTVVTPMLNPFIYSLRNRDIQSTLRRLLSRTVESHDL
FHPFSCV
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 10 36 QPVLAGLSLSMCLVTVLRNLLSILAVS
TM2 47 69 FFLSNLCWADIGFTSATVPKIIV
TM3 84 104 LTRMSFLVLFACIEDMLLTVM
TM4 127 147 RVFLVLVSFFLSLLDSQLHSX
TM5 184 205 FIYFDSTMFGFLPISGILLSYC
TM6 227 251 CGSHLALVCLFYGAGIGVYLTSAVS
TM7 257 276 GVVVSVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage