Protein information for: OR7E128P



LVFIFYFSNPLSFSRCPRHTEPRNLTSVXFLLLGLSEDPELQPLLALLSL
SLSMHLVMVLRNLLNILAVSSDSPLHTPTYFFLSNLCWADTGFTSATVPN
MIVDMQSHSRVISHADCLTQISFLLLFACIEGMLLTVMTYDCFVAICCPL
HYPVIVNPHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNSVCD
PSQLLKLACSDSVINSIFMHFHNTMFGFLPISGILVSYYKIVPSILRISS
SDGKYKAFSTCGSHLAVVCXFYGTGIGVYLTSALSPPPRNGVMASVMYAV
VTPMLNLFIYSLRNRDIQSALWRLLSRTVESHDLFHPFSCVGK
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 44 70 LLALLSLSLSMHLVMVLRNLLNILAVS
TM2 81 103 FFLSNLCWADTGFTSATVPNMIV
TM3 118 138 LTQISFLLLFACIEGMLLTVM
TM4 161 181 CVFFVLVSFFLSLLDSQLHSW
TM5 218 239 FMHFHNTMFGFLPISGILVSYY
TM6 261 285 CGSHLAVVCXFYGTGIGVYLTSALS
TM7 291 310 GVMASVMYAVVTPMLNLFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage