Protein information for: OR7E12P



NDTDPQSLTDVSIFLLLKLSEDPELQQVVAGLFLSMCLVTVLGNLLIILA
VSPDSHLHTPMYLFLSNLSLPDIGFTSTTVPKMIVDIQSHSRVISYAGCL
TQMSLFAIFGGEEDMLLSVMAYDRFVAICHPLYCSAIFNPCFCGFLVCCL
FFFFLSLSDSQLHNLIALQMTCFKDVEIPNFFWEPSQLSHLACCDTFTRN
IMYFPAAIFGFLPILGTLFSYCKIVSSILRVSSSGGKYKAFSTCGSHLSV
VCXFYGTGIGGYLGSDVSSSPRKGAVASVMYMVVTPMLNPFIYSLRNRDM
KSVLRRPHGSTV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QQVVAGLFLSMCLVTVLGNLLIILAVS
TM2 63 85 LFLSNLSLPDIGFTSTTVPKMIV
TM3 100 120 LTQMSLFAIFGGEEDMLLSVM
TM4 143 163 CGFLVCCLFFFFLSLSDSQLH
TM5 201 222 IMYFPAAIFGFLPILGTLFSYC
TM6 244 268 CGSHLSVVCXFYGTGIGGYLGSDVS
TM7 274 293 GAVASVMYMVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage