Protein information for: OR7E158P



FQPSFLGKSCPNSTDPQNLTDVSLFLLLELSQDPELQPVVTGLFLSMCLV
TVLGNPLILLSVSPESHLHTPMYFFLSNLSLPDIGFTSTAVPKMIVDIQS
HSRVISYAGRLTQMSLFAIFGGEEDMLLSVMAYDRFVAICHPLYHSATMN
PCFCGFLLLLSFFFFSGLLEVQLHNLIALRMNCFKDVEIPNFFCDPSQLP
HIACCDTFTNNIIMHFPAAIFGFPPISGTLFSYSKIVFSILRVSSSGGKY
KAFSTCGSYLSVVCXFYGTGVGSYLSSDVSSSLRQGAVASVMYTVVTPM
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 QPVVTGLFLSMCLVTVLGNPLILLSVS
TM2 74 96 FFLSNLSLPDIGFTSTAVPKMIV
TM3 111 131 LTQMSLFAIFGGEEDMLLSVM
TM4 154 174 CGFLLLLSFFFFSGLLEVQLH
TM5 213 234 IMHFPAAIFGFPPISGTLFSYS
TM6 256 280 CGSYLSVVCXFYGTGVGSYLSSDVS
TM7 286 298 AVASVMYTVVTPM

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage