Protein information for: OR7E15P



FEPSFLGKRCSISTYPQNLTDVSLFLLLEVSEDPEQQPVLAGLFLSMCLV
TVLGNLLIILAVSPDSHLHTPMYLFLSNLSLPDIGFTSSMVPKMIVDIXS
HSRLISXAGCLTPMSLFAIFGGEEDMLLSVIAYDPFVAICHPLYHSAIMN
PCFCGFLVLLSFFSQSLLDAQVHNLIALQMTCFKDVEIPNFFWEPSQLPH
LACCDTFTNNIIMYSPAAIFGFLPISGTLFSYYKIVSSILRVSSSGGKYK
ACSTCGSHLSVVCXFYGTGFWGYLSSDVSSSPGKAAVASVMYTVVTPMPN
PFIYSLRNRDIKSVLRRPHGSTV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 QPVLAGLFLSMCLVTVLGNLLIILAVS
TM2 74 96 LFLSNLSLPDIGFTSSMVPKMIV
TM3 111 131 LTPMSLFAIFGGEEDMLLSVI
TM4 154 174 CGFLVLLSFFSQSLLDAQVHN
TM5 212 233 IMYSPAAIFGFLPISGTLFSYY
TM6 255 279 CGSHLSVVCXFYGTGFWGYLSSDVS
TM7 285 304 AAVASVMYTVVTPMPNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage