Protein information for: OR7E18P



IQCKGXXKXIKTFSVTPILNGNREIARFLSNLSLAGIGFPSTIVSKMIVD
IQSHSRVISYAGCLTQVSLFAVFGCMEDMLLSVMAYDRFVDICHPLDYPV
IMNPCFCGFLVLLSFFLSLLDSQLHNWIALQITCFKDVEIPNFFCDPSQL
PHLACCDTFTNDIVMYFLAAIFGFLPISGTLFSYYKIVSSILRVSSSGGK
YKAFSTCGSHLSVVCLFYGTGFGGDLSSDMSSYPRKGAVASVMYTVVTPM
LNPFIYSLSREIKSALRQLHCRIV
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 0 19 IQCKGXXKXIKTFSVTPILN
TM2 27 48 FLSNLSLAGIGFPSTIVSKMIV
TM3 64 84 LTQVSLFAVFGCMEDMLLSVM
TM4 107 127 CGFLVLLSFFLSLLDSQLHNW
TM5 164 185 VMYFLAAIFGFLPISGTLFSYY
TM6 207 231 CGSHLSVVCLFYGTGFGGDLSSDMS
TM7 237 256 GAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage