Protein information for: OR7E19P



IYVFYFFNPLFFSRCPSYTDSQNLTGVLEFLFLGLSEDPELQPVLVGLFL
SMYLITVLGNLLIILAVSCDSHLHTPMYFFLSNLSLADIGLTSATIPKMI
VDMQSHSRIISYEGCLMQMSFIYFVCMNDMVLTVMAYDQFVAICHPLRYP
VIMNPHLCVFLVLVSFILSLLNSQLHNQIVLQFTCFKNVEIFNFFCEPSQ
LLNLACSDSVINNIFMYLDSVIFGFLPISGILLSYYKIVSSILRIPSSDG
KYKAFSTCGSHLAVVCLFYGTGLGAYLSSAASSFPRKGAVTSVMYTVVIP
MLNPFIYSLRNRDIKSALWRLHSRTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 42 68 QPVLVGLFLSMYLITVLGNLLIILAVS
TM2 79 101 FFLSNLSLADIGLTSATIPKMIV
TM3 116 135 LMQMSFIYFVCMNDMVLTVM
TM4 158 178 CVFLVLVSFILSLLNSQLHNQ
TM5 215 236 FMYLDSVIFGFLPISGILLSYY
TM6 258 282 CGSHLAVVCLFYGTGLGAYLSSAAS
TM7 288 307 GAVTSVMYTVVIPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage