Protein information for: OR7E1P



LVFICYFSNPLSFSRCPRHTEPRNLTGVXFLLLGLSEDPELQPILALLSL
SLSMYLVTVLRNLLSILAVCSDSPLHTPRYFFLSNLCWADIGFTSATVPK
MIVDMQSHSRVTSHAGCLTQMSFLVLFACIEGMLLTVMAYDCFVAICRPL
HYPVIVNPHLCVFVLVSFFLSLLDSQLHSWIVLQFTIVXNLEISNFVCDP
SQLLKLACSDSVINSIFIYFDSTMFGFLPISGILWSYYKIIPSILRISSS
DGKYKAFSTCGSHLAVVCXFYGTGIGMYLTSAVSQPPRNGVVASVMYAVV
TPMLNLFIYSLRNRNIQSALWRLHSTTVESHDLFHPFSCV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 44 70 ILALLSLSLSMYLVTVLRNLLSILAVC
TM2 81 103 FFLSNLCWADIGFTSATVPKMIV
TM3 118 138 LTQMSFLVLFACIEGMLLTVM
TM4 161 181 CVFVLVSFFLSLLDSQLHSWI
TM5 217 238 FIYFDSTMFGFLPISGILWSYY
TM6 260 284 CGSHLAVVCXFYGTGIGMYLTSAVS
TM7 290 309 GVVASVMYAVVTPMLNLFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage