Protein information for: OR7E21P



LFPILQPSFPGKRGSYPNDTDPQSLTDVSIFLLLELSEDPELQPVVAGLF
LSMCLVTVLGNLLIILAVSPDSHLPTPMYFFLSNLSLPDIGFTSTTVPKM
SVDIQSHSRVISYAGCLTQMSLFAIFGGEERHAPEVMAYDLFVAICHLLY
RSAILNPFVRGFLVCCLCCWFFFFFLSLLDSQLHNLIALQMTYFKDVEIP
NFFWEPSQLPHLACCDTFTRNNNMYFPAAVFGFLPISGTLFSYCKIVSSI
LRVSSSGGKYKAFSTCGSHLSVVCXFYGAGVGGYLGSDVSSSPRKGAVAS
VTYVHVVTPMLNSFIYSLRNGDIKSVLRRPHGSTVXSQYVLHLFHSFCRV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 43 69 QPVVAGLFLSMCLVTVLGNLLIILAVS
TM2 80 102 FFLSNLSLPDIGFTSTTVPKMSV
TM3 117 137 LTQMSLFAIFGGEERHAPEVM
TM4 162 182 FLVCCLCCWFFFFFLSLLDSQ
TM5 223 244 NMYFPAAVFGFLPISGTLFSYC
TM6 266 290 CGSHLSVVCXFYGAGVGGYLGSDVS
TM7 297 316 AVASVTYVHVVTPMLNSFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage