Protein information for: OR7E25P



FCPFLFSNSLFLNCCPRYTEPENLTGVLEFLLLGLPDDPELQPVLFGLFL
SMYLVMVLGNLLIILAVSSDSHLHSPMYFFLSNLSLADIGFASTTVPKMI
VDIQAHSRLISYVGCLTQMSFLIFFACMESLLLIVMAYDRFVAICHPLHY
QVIMSPRLCGFLVLVSFFLSLLDSQLHNLIVLQLTCFNDVEISNFFCDPS
XLLKLACSDTSINNMVVYFIGAIFGFLPLLGILFSYYKIVSSILRVLSSG
GKYKAFSTCSSHLSVVCLLYGTALGGYLSSAVSLSSRKGAVASVMYMVVT
PMLNPFIYSLRNRDIQSALQRLHGRIM
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 42 68 QPVLFGLFLSMYLVMVLGNLLIILAVS
TM2 79 101 FFLSNLSLADIGFASTTVPKMIV
TM3 116 136 LTQMSFLIFFACMESLLLIVM
TM4 159 179 CGFLVLVSFFLSLLDSQLHNL
TM5 216 237 VVYFIGAIFGFLPLLGILFSYY
TM6 259 283 CSSHLSVVCLLYGTALGGYLSSAVS
TM7 289 308 GAVASVMYMVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage