Protein information for: OR7E26P



PSFLGKSCPISTDPQNLTDVSIFLLLEVSEDPEWQPVLTGLCLSMCLVTV
LGNLLIILAVSPDSHLHIPMYFFLSNLSLPDIGFTSTTVPKMIVDIQSHS
RVISYAGCLTQMSLFAIFGGEEDMLLSVIAYERFVAICHPLYHSAIMNPC
FCGFLVLLSFFFLSLLDAQLHNLIALQRTCFKDVEIPNFFCDPSQLSHLA
YCGTFTNNIIMYFPAAIFGFLPISGTLFSYNKIVFSILRVSSSGGKYKAF
STCGSHLSVVCXFYGTGIGGYLGSDVSSSPRKAAVASVMYTVVIPMPNPF
IYSLRNRDMKSVLQRPHGSTISSQYLL
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 35 61 QPVLTGLCLSMCLVTVLGNLLIILAVS
TM2 72 94 FFLSNLSLPDIGFTSTTVPKMIV
TM3 109 129 LTQMSLFAIFGGEEDMLLSVI
TM4 152 172 CGFLVLLSFFFLSLLDAQLHN
TM5 210 231 IMYFPAAIFGFLPISGTLFSYN
TM6 253 277 CGSHLSVVCXFYGTGIGGYLGSDVS
TM7 283 302 AAVASVMYTVVIPMPNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage