Protein information for: OR7E2P



LAFWILGTISQKACTTPCDTGRQPVLTGLSLSMYLVTMLRNLFIILAGSS
DPHFHTPMYFFLSNLSWADIGFTSATVPKMIVDMQSHSRVISYAGCLTQM
SFFVLFACIEDMLLTLMAYDRFVAICHIPLHYRVIMNPHLCVFLVLVSFF
LSLLDSQLHSWIVLLQLTFFKNVEIYNFFCCDPSQLLNLACSDSIINNIL
CILDIPIFGFLPISGILLSYYKIVSSIPRIPSSDGKYKAFSTCGSHLAVV
CLFYETGIGVYLTSAVSSSPRNGVVASVMYAVVIPMLNPFIYSLRNRDIH
SALWRLRSRTVKSHDLFHPFSCVSK
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 23 49 QPVLTGLSLSMYLVTMLRNLFIILAGS
TM2 60 82 FFLSNLSWADIGFTSATVPKMIV
TM3 97 117 LTQMSFFVLFACIEDMLLTLM
TM4 141 161 CVFLVLVSFFLSLLDSQLHSW
TM5 200 221 LCILDIPIFGFLPISGILLSYY
TM6 243 267 CGSHLAVVCLFYETGIGVYLTSAVS
TM7 273 292 GVVASVMYAVVIPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage