Protein information for: OR7E31P



CPISTDPQNLIDVFVFLLLELSEDPERQLVLAGLFLSMCLVTVLGNLLII
LAVSPDSHLHTPMYFFLSNLSLPDIGFTSTTVPKLIVDIQSYSRVISYAG
CLTQTSLFAIFGGEEDMLLSVMVYDRFVAICHPLYHSAVMNPCFCGFLVL
LSFFFLSLLDAQLHNLIALQMTCFKDVEIPNFFCDPSQLPHLACCDTFTN
NIIMYFPAAIFGFLPISGTLFSYYEIVSSILRVSSXGGKYKAFATCGSHL
SVVCXFYGTGVGGYLSSDVSSSPRKAAVASVMYTVVTPMLNPFIYSLRNR
DTKSVLRRPHGSTV
No N-glycosylation site was found.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 QLVLAGLFLSMCLVTVLGNLLIILAVS
TM2 65 87 FFLSNLSLPDIGFTSTTVPKLIV
TM3 102 122 LTQTSLFAIFGGEEDMLLSVM
TM4 145 165 CGFLVLLSFFFLSLLDAQLHN
TM5 203 224 IMYFPAAIFGFLPISGTLFSYY
TM6 246 270 CGSHLSVVCXFYGTGVGGYLSSDVS
TM7 276 295 AAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage