Protein information for: OR7E33P



CPISTDPQNLTDVSIFLLLELSEDPEXQPVLAGLFLSMCLVTVLGNLLII
LAVSPDSHLHTPMYIFFSNLSLPDIGFTSTTVPKMTVDIQSHSRVISYAG
CLTQMSLFAIFGGEEDMFLSVMAYDRFVAICHPLYHSAIMNPCFCGFLVL
LSFFFSLSLLDVQLRNLIALQMTCFKDVEIPNFFCDPSQLPHLACCDTFT
NNIILYFPAAIFGFLPILGTLFSYYKIVFSILRVSSSGGKYKAFSTCVSH
LSVVCXFYGTGVGGYLSSDVSSSPRKAAVASVMYTVVTPMLNPFIYSLRN
RDIKSVLRRPHSSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 QPVLAGLFLSMCLVTVLGNLLIILAVS
TM2 65 87 IFFSNLSLPDIGFTSTTVPKMTV
TM3 102 122 LTQMSLFAIFGGEEDMFLSVM
TM4 145 165 CGFLVLLSFFFSLSLLDVQLR
TM5 204 225 ILYFPAAIFGFLPILGTLFSYY
TM6 247 271 CVSHLSVVCXFYGTGVGGYLSSDVS
TM7 277 296 AAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage