Protein information for: OR7E36P



LLVSDFSTSFLGKRCSISTDPQNLTDVSVFLLLELSEDPERQPVLTGLFL
SMCLVTVLGNLLIILAISPDSHLHIPMYFFLSNLSLPDIGFTSTTVPKMI
VDIQSHSRVISYAGCLTQMSLFAIFGGEEDMLLSVMAYDRFVAICHPLYH
SAIMNPCFCGFLVLLSFFFLSLSLLDSQLHNLIALQVTCFKDVEIPNFFC
DPSQLPHLACCDTFTNKIIMYFPAAIFGFLPISGTLFSYSKIVSSILRVS
SSGGKYKAFSTCGSHLSVVCXVYGTGVGGYLSSDDVSSSPRKGAVASVMY
TVVTPMLNPFIYSLRNRDIKGVLRRPHGSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 42 68 QPVLTGLFLSMCLVTVLGNLLIILAIS
TM2 79 101 FFLSNLSLPDIGFTSTTVPKMIV
TM3 116 136 LTQMSLFAIFGGEEDMLLSVM
TM4 159 179 CGFLVLLSFFFLSLSLLDSQL
TM5 219 240 IMYFPAAIFGFLPISGTLFSYS
TM6 262 286 CGSHLSVVCXVYGTGVGGYLSSDDV
TM7 293 312 GAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage