Protein information for: OR7E39P



LQPSFLGKRYPNYAEPQNLTDVSLFLLLELSGDPELQLVLAGLFLSICLV
MVLGNLLIILAISPDSHLHTPVYFFLSNLSLPDISFTSTTVPKMIVDIQS
HSRVISYAGCLTQMSLFVIFGGEESMLLSVMAYDWFVAICHPLYHSAIMN
PCFCGFLVLLSFFFLSLLDAQLHNLIALQVTCFKDVEIPNFFCDPSQLPH
LACCDTFTINIIMYFPAAIFGFLPISGTLFSYSKIVSSILRVSSSGGRYK
ALSTCGSHLSVVCXVYGTGVGGYLSSDVSFSPRKGAVASVMYAVVTPMLN
PFVYSLRNRDVKGVLRRPHGSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 QLVLAGLFLSICLVMVLGNLLIILAIS
TM2 74 96 FFLSNLSLPDISFTSTTVPKMIV
TM3 111 131 LTQMSLFVIFGGEESMLLSVM
TM4 154 174 CGFLVLLSFFFLSLLDAQLHN
TM5 212 233 IMYFPAAIFGFLPISGTLFSYS
TM6 255 279 CGSHLSVVCXVYGTGVGGYLSSDVS
TM7 285 304 GAVASVMYAVVTPMLNPFVY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage