Protein information for: OR7E41P



CPSHTEPQNLTGVSEFLLLGLSEDPELQPLLAGLFLSMCLVTMLGNLLII
LAVSPDSHLHIPMYFFLSNLSLPDIGFTLATVPKMIVDMQSHSRVISHAG
CLTQIPFFVLFVCIDDMLLTVMAYDXFVAICHPLHYPVIMNPHLCVFLVL
MSFFLSLLDSXLHNWIVQFTCFKNVEISNFFCDXSQLLNLACSDVISNIF
IHLDSTIFGFLPISGILLSYYKIVPSILRIPLSDGKYKAFSTCGSHLAIV
CLFYGTGIGMYLTSAVSPAPRNGVVASVLYAMVTPMLNPFICSLRNRGIQ
SALWRLCRRKV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 28 54 QPLLAGLFLSMCLVTMLGNLLIILAVS
TM2 65 87 FFLSNLSLPDIGFTLATVPKMIV
TM3 102 122 LTQIPFFVLFVCIDDMLLTVM
TM4 145 165 CVFLVLMSFFLSLLDSXLHNW
TM5 200 221 FIHLDSTIFGFLPISGILLSYY
TM6 243 267 CGSHLAIVCLFYGTGIGMYLTSAVS
TM7 273 292 GVVASVLYAMVTPMLNPFIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage