Protein information for: OR7E43P



FQPSFLGKRCPNSTDPQNVTDVSRFLLLKLSEDPELQPVLAGLFLSMCLV
TVLGNLLIILAVSPDSHLHTSMYFFLSNLSLPDIGFPSPTVPKMVVDIQS
HRVISYAGCLTQMSLFAIFGGEENMLLNVMAYVRFVAICHPLYHSAIMNP
CFCGFLLLLSFFLGLLDAQLHNMIALQMTCFKDVEIPNFFCDPSQLPHLA
CCDTFTNNIIMYFPAAVFGFLPISGTLFSYSKIVSSILRVSSSGGKYKAF
STCGSHLSVFCXFYGTGIGGYLSSDVSSSLRKAAVASLMYKMVTPMLNPS
IYSLRNRDIKSVLRQPHGSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 37 63 QPVLAGLFLSMCLVTVLGNLLIILAVS
TM2 74 96 FFLSNLSLPDIGFPSPTVPKMVV
TM3 110 130 LTQMSLFAIFGGEENMLLNVM
TM4 153 173 CGFLLLLSFFLGLLDAQLHNM
TM5 210 231 IMYFPAAVFGFLPISGTLFSYS
TM6 253 277 CGSHLSVFCXFYGTGIGGYLSSDVS
TM7 283 302 AAVASLMYKMVTPMLNPSIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage