Protein information for: OR7E47P



SCPNYTDPQNLTDVSIFLLLELSEDPERQLVLAGLFLSMCLVMVLGNLLI
ILAMSPDSHLHTSMYFFLSNLSLPDIGFTSTTVPQMTVDIQSRSRVISYA
GCLTQKSLFAIFGGEEDMLLSVMAYDRFVAICHPLYHSAIMNLCFCGFLV
LLSFFFLSLLDSQLYNLIALLMTCFKEVDIPNFFCDLSQLPHLARCDTFI
NNIIMYFPTAIFGFLPISGTLFSYYKIVSSILRVSSSGGKYKAFSTCGSH
LSVVCXFYGRGVGGYLSSDVSSSPRKGAVAAVMYTVVTSMLNPFIYSLGN
RDIKSVLRRPHGSTV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 29 55 QLVLAGLFLSMCLVMVLGNLLIILAMS
TM2 66 88 FFLSNLSLPDIGFTSTTVPQMTV
TM3 103 123 LTQKSLFAIFGGEEDMLLSVM
TM4 146 166 CGFLVLLSFFFLSLLDSQLYN
TM5 204 225 IMYFPTAIFGFLPISGTLFSYY
TM6 247 271 CGSHLSVVCXFYGRGVGGYLSSDVS
TM7 277 296 GAVAAVMYTVVTSMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage