Protein information for: OR7E55P



NDTDPQSLTDVSIFLLLELSEDPELQPVLAGLFLSMCLVTVLRNLLIILA
ISPDSHLHTPMYFFLSNLSFPDIGFTSTTVPKMIVDIQSHSRVISYAGCL
TQMSLFAIFGDEEDMFLSVVAYDRFVAICHPLYRSAILNPCFCGFLVRCP
FFLSLLDSQLHNLIALQTTCFKDVEIPNFFWEPSQLPHLACCDIFTRNIN
LYFPAAIFGFLPISGTLFSYYKIVSFILRVSSSGGKYKAFSACGSHLSVV
YXFYGTGFGGYLSSDVSSSPRKGAVASVMYTVVTPMLNPFIYSLRNGDIK
SVLRQPHGSTV
In red: predicted N-glycosylation site.
Cysteines that are predicted to form a disulfide bond do not occur.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 26 52 QPVLAGLFLSMCLVTVLRNLLIILAIS
TM2 63 85 FFLSNLSFPDIGFTSTTVPKMIV
TM3 100 120 LTQMSLFAIFGDEEDMFLSVV
TM4 143 163 CGFLVRCPFFLSLLDSQLHNL
TM5 200 221 NLYFPAAIFGFLPISGTLFSYY
TM6 243 267 CGSHLSVVYXFYGTGFGGYLSSDVS
TM7 273 292 GAVASVMYTVVTPMLNPFIY

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage