Protein information for: OR7E5P



LFFSWCPSDTEPQNLTAVSEFLLLGLSEDPELQPILAGLFLSMYLVTVLG
NLLIILAIGSDSHLDTPMYFFLSNLSLPDIGFTSATVPKMIEEMQSHSRV
IYHGDCLTQMSFFVLFACKDDMILTVMAYDWFVAICHPLNYPGIMNPHLC
VLLVLVPFFLSLLDSQLHNLIVLQFICFKNVEISNFFCDPFQRLNLACSD
SDINNIYIYLDSTIFGFLRISGILLCYYTVAFPILRIPSSDGNYKAFSTX
GSRLAVVCLFYGTGIGVYLTSAVSSSPRNDVVASVMYAVVVTPMLNPFIC
SLRNRDIQSALWRLHSRTVXSHDLFHPFSCV
In red: predicted N-glycosylation site.
In magenta: Conserved cysteines that are predicted to form a disulfide bond.
Underlined and bold: TM regions.

Predicted binding site residues (CDRs) are highlighted according to the following amino acid color code:
| | basic (H,R,K)
| | hydrophilic, no charge (Q,N,T,S)
| | aliphatic (M,A,I,L,V)
| | aromatic (F,Y,W)
| | helix breakers (G,P)
| | acidic (D,E)
| | cysteine (C)

Sequences of the TM regions:

TM

Start position

End position

Sequence

TM1 33 59 QPILAGLFLSMYLVTVLGNLLIILAIG
TM2 70 92 FFLSNLSLPDIGFTSATVPKMIE
TM3 107 127 LTQMSFFVLFACKDDMILTVM
TM4 150 170 CVLLVLVPFFLSLLDSQLHNL
TM5 207 228 YIYLDSTIFGFLRISGILLCYY
TM6 250 274 XGSRLAVVCLFYGTGIGVYLTSAVS
TM7 281 300 VVASVMYAVVVTPMLNPFIC

The information was derived from a multiple alignment of ORs, based on the algorithms of Man et al. Protein Sci. 2004 Jan;13(1):240-54.
HORDE homepage